CASQ1 (NM_001231) Human Mass Spec Standard

CAT#: PH304696

CASQ1 MS Standard C13 and N15-labeled recombinant protein (NP_001222)

Product Images

Coomassie blue staining of purified CASQ1 protein (Cat# TP304696). The protein was produced from HEK293T cells transfected with CASQ1 cDNA clone (Cat# RC204696) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204696
• Predicted MW: 44.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204696 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGPRAVPGLRLALLLLLVLGTPKSGVQGQEGLDFPEYDGVDRVINVNAKNYKNVFKKYEVLALLYHEPPE
  DDKASQRQFEMEELILELAAQVLEDKGVGFGLVDSEKDAAVAKKLGLTEVDSMYVFKGDEVIEYDGEFSA
  DTIVEFLLDVLEDPVELIEGERELQAFENIEDEIKLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFATFDS
  KVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWEDDMDGIHIV
  AFAEEADPDGFEFLETLKAVAQDNTENPDLSIIWIDPDDFPLLVPYWEKTFDIDLSAPQIGVVNVTDADS
  VWMEMDDEEDLPSAEELEDWLEDVLEGEINTEDDDDDDDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001222
• RefSeq Size: 1993
• RefSeq ORF: 1170
• Synonyms: CASQ; PDIB1; VMCQA
• Locus ID: 844
• UniProt ID: P31415
• Cytogenetics: 1q23.2
• Summary: 'This gene encodes the skeletal muscle specific member of the calsequestrin protein family. Calsequestrin functions as a luminal sarcoplasmic reticulum calcium sensor in both cardiac and skeletal muscle cells. This protein, also known as calmitine, functions as a calcium regulator in the mitochondria of skeletal muscle. This protein is absent in patients with Duchenne and Becker types of muscular dystrophy. [provided by RefSeq, Jun 2013]'