SLPI (NM_003064) Human Mass Spec Standard
CAT#: PH304697
SLPI MS Standard C13 and N15-labeled recombinant protein (NP_003055)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204697 |
Predicted MW | 14.3 kDa |
Protein Sequence |
>RC204697 protein sequence
Red=Cloning site Green=Tags(s) MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGI KCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003055 |
RefSeq Size | 625 |
RefSeq ORF | 396 |
Synonyms | ALK1; ALP; BLPI; HUSI; HUSI-I; MPI; WAP4; WFDC4 |
Locus ID | 6590 |
UniProt ID | P03973 |
Cytogenetics | 20q13.12 |
Summary | 'This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity. [provided by RefSeq, Nov 2014]' |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418925 | SLPI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418925 | Transient overexpression lysate of secretory leukocyte peptidase inhibitor (SLPI) |
USD 396.00 |
|
TP304697 | Recombinant protein of human secretory leukocyte peptidase inhibitor (SLPI) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review