SLPI (NM_003064) Human Recombinant Protein
CAT#: TP304697
Recombinant protein of human secretory leukocyte peptidase inhibitor (SLPI)
View other "SLPI" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204697 protein sequence
Red=Cloning site Green=Tags(s) MKSSGLFPFLVLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGKKRCCPDTCGI KCLDPVDTPNPTRRKPGKCPVTYGQCLMLNPPNFCEMDGQCKRDLKCCMGMCGKSCVSPVKA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003055 |
Locus ID | 6590 |
UniProt ID | P03973 |
Cytogenetics | 20q13.12 |
Refseq Size | 625 |
Refseq ORF | 396 |
Synonyms | ALK1; ALP; BLPI; HUSI; HUSI-I; MPI; WAP4; WFDC4 |
Summary | This gene encodes a secreted inhibitor which protects epithelial tissues from serine proteases. It is found in various secretions including seminal plasma, cervical mucus, and bronchial secretions, and has affinity for trypsin, leukocyte elastase, and cathepsin G. Its inhibitory effect contributes to the immune response by protecting epithelial surfaces from attack by endogenous proteolytic enzymes. This antimicrobial protein has antibacterial, antifungal and antiviral activity. [provided by RefSeq, Nov 2014] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418925 | SLPI HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418925 | Transient overexpression lysate of secretory leukocyte peptidase inhibitor (SLPI) |
USD 396.00 |
|
PH304697 | SLPI MS Standard C13 and N15-labeled recombinant protein (NP_003055) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review