PRAF1 (POLR1E) (NM_022490) Human Mass Spec Standard

CAT#: PH304811

POLR1E MS Standard C13 and N15-labeled recombinant protein (NP_071935)

Product Images

Coomassie blue staining of purified POLR1E protein (Cat# TP304811). The protein was produced from HEK293T cells transfected with POLR1E cDNA clone (Cat# RC204811) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204811
• Predicted MW: 47.2 kDa
• Protein Sequence:
  Sequence Link

  >RC204811 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAEVLPSARWQYCGAPDGSQRAVLVQFSNGKLQSPGNMRFTLYENKDSTNPRKRNQRILAAETDRLSYV
  GNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAELFNMQPLFSDVSVESELALESQTKTYREKMDSCIE
  AFGTTKQKRALNTRRMNRVGNESLNRAVAKAAETIIDTKGVTALVSDAIHNDLQDDSLYLPPCYDDAAKP
  EDVYKFEDLLSPAEYEALQSPSEAFRNVTSEEILKMIEENSHCTFVIEALKSLPSDVESRDRQARCIWFL
  DTLIKFRAHRVVKRKSALGPGVPHIINTKLLKHFTCLTYNNGRLRNLISDSMKAKITAYVIILALHIHDF
  QIDLTVLQRDLKLSEKRMMEIAKAMRLKISKRKVSVAAGSEEDHKLGTLSLPLPPAQTSDRLAKRRKIT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071935
• RefSeq Size: 1884
• RefSeq ORF: 1257
• Synonyms: PAF53; PRAF1
• Locus ID: 64425
• UniProt ID: Q9GZS1
• Cytogenetics: 9p13.2
• Protein Families: Transcription Factors
• Protein Pathways: Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase