RPB11 (POLR2J) (NM_006234) Human Mass Spec Standard

CAT#: PH304819

POLR2J MS Standard C13 and N15-labeled recombinant protein (NP_006225)

Product Images

Coomassie blue staining of purified POLR2J protein (Cat# TP304819). The protein was produced from HEK293T cells transfected with POLR2J cDNA clone (Cat# RC204819) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204819
• Predicted MW: 13.3 kDa
• Protein Sequence:
  Sequence Link

  >RC204819 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHK
  IIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006225
• RefSeq Size: 991
• RefSeq ORF: 351
• Synonyms: hRPB14; POLR2J1; RPB11; RPB11A; RPB11m
• Locus ID: 5439
• UniProt ID: P52435
• Cytogenetics: 7q22.1
• Summary: 'This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008]'
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase