RPB11 (POLR2J) (NM_006234) Human Recombinant Protein

CAT#: TP304819

Recombinant protein of human polymerase (RNA) II (DNA directed) polypeptide J, 13.3kDa (POLR2J)

Product Images

Coomassie blue staining of purified POLR2J protein (Cat# TP304819). The protein was produced from HEK293T cells transfected with POLR2J cDNA clone (Cat# RC204819) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204819 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAGYKVPHPLEHK
  IIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006225
• Locus ID: 5439
• UniProt ID: P52435
• Cytogenetics: 7q22.1
• Refseq Size: 991
• Refseq ORF: 351
• Synonyms: hRPB14; POLR2J1; RPB11; RPB11A; RPB11m
• Summary: This gene encodes a subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene exists as a heterodimer with another polymerase subunit; together they form a core subassembly unit of the polymerase. Two similar genes are located nearby on chromosome 7q22.1 and a pseudogene is found on chromosome 7p13. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Metabolic pathways, Purine metabolism, Pyrimidine metabolism, RNA polymerase