Granzyme A (GZMA) (NM_006144) Human Mass Spec Standard

CAT#: PH304852

GZMA MS Standard C13 and N15-labeled recombinant protein (NP_006135)

Product Images

Coomassie blue staining of purified GZMA protein (Cat# TP304852). The protein was produced from HEK293T cells transfected with GZMA cDNA clone (Cat# RC204852) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204852
• Predicted MW: 29 kDa
• Protein Sequence:
  Sequence Link

  >RC204852 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRNSYRFLASSLSVVVSLLLIPEDVCEKIIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHC
  NLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLTEKAKINKYVTILHLPKKGD
  DVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNG
  DSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006135
• RefSeq Size: 913
• RefSeq ORF: 786
• Synonyms: CTLA3; HFSP
• Locus ID: 3001
• UniProt ID: P12544
• Cytogenetics: 5q11.2
• Summary: 'Cytolytic T lymphocytes (CTL) and natural killer (NK) cells share the remarkable ability to recognize, bind, and lyse specific target cells. They are thought to protect their host by lysing cells bearing on their surface 'nonself' antigens, usually peptides or proteins resulting from infection by intracellular pathogens. The protein described here is a T cell- and natural killer cell-specific serine protease that may function as a common component necessary for lysis of target cells by cytotoxic T lymphocytes and natural killer cells. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Protease, Secreted Protein
• Protein Pathways: Neuroactive ligand-receptor interaction