Septin 2 (SEPT2) (NM_004404) Human Mass Spec Standard

CAT#: PH304867

SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_004395)

Product Images

Coomassie blue staining of purified SEPTIN2 protein (Cat# TP304867). The protein was produced from HEK293T cells transfected with SEPTIN2 cDNA clone (Cat# RC204867) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204867
• Predicted MW: 41.5 kDa
• Protein Sequence:
  Sequence Link

  >RC204867 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISG
  AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH
  IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI
  YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML
  ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG
  DGDGGALGHHV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004395
• RefSeq Size: 3323
• RefSeq ORF: 1083
• Synonyms: DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3; SEPT2
• Locus ID: 4735
• UniProt ID: Q15019
• Cytogenetics: 2q37.3
• Summary: ''