Septin 2 (SEPT2) (NM_004404) Human Mass Spec Standard
CAT#: PH304867
SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_004395)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC204867 |
Predicted MW | 41.5 kDa |
Protein Sequence |
>RC204867 protein sequence
Red=Cloning site Green=Tags(s) MSKQQPTQFINPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVISG AAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINCRDCFKTIISYIDEQFERYLHDESGLNRRH IIDNRVHCCFYFISPFGHGLKPLDVAFMKAIHNKVNIVPVIAKADTLTLKERERLKKRILDEIEEHNIKI YHLPDAESDEDEDFKEQTRLLKASIPFSVVGSNQLIEAKGKKVRGRLYPWGVVEVENPEHNDFLKLRTML ITHMQDLQEVTQDLHYENFRSERLKRGGRKVENEDMNKDQILLEKEAELRRMQEMIARMQAQMQMQMQGG DGDGGALGHHV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_004395 |
RefSeq Size | 3323 |
RefSeq ORF | 1083 |
Synonyms | DIFF6; hNedd5; NEDD-5; NEDD5; Pnutl3; SEPT2 |
Locus ID | 4735 |
UniProt ID | Q15019 |
Cytogenetics | 2q37.3 |
Summary | '' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416834 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418011 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423437 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC423438 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425241 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425242 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429285 | 42249 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416834 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 2 |
USD 396.00 |
|
LY418011 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 4 |
USD 396.00 |
|
LY423437 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 |
USD 396.00 |
|
LY423438 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 3 |
USD 396.00 |
|
LY425241 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 1 |
USD 396.00 |
|
LY425242 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 3 |
USD 396.00 |
|
LY429285 | Transient overexpression lysate of septin 2 (SEPT2), transcript variant 2 |
USD 396.00 |
|
PH311473 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_006146) |
USD 2,055.00 |
|
PH311650 | SEPT2 MS Standard C13 and N15-labeled recombinant protein (NP_001008492) |
USD 2,055.00 |
|
TP304867 | Recombinant protein of human septin 2 (SEPT2), transcript variant 4 |
USD 823.00 |
|
TP311473 | Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 2 |
USD 748.00 |
|
TP311650 | Purified recombinant protein of Homo sapiens septin 2 (SEPT2), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review