Frataxin (FXN) (NM_000144) Human Mass Spec Standard

CAT#: PH304880

FXN MS Standard C13 and N15-labeled recombinant protein (NP_000135)

Product Images

Coomassie blue staining of purified FXN protein (Cat# TP304880). The protein was produced from HEK293T cells transfected with FXN cDNA clone (Cat# RC204880) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204880
• Predicted MW: 23.1 kDa
• Protein Sequence:
  Sequence Link

  >RC204880 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK
  QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL
  GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000135
• RefSeq Size: 7168
• RefSeq ORF: 630
• Synonyms: CyaY; FA; FARR; FRDA; X25
• Locus ID: 2395
• UniProt ID: Q16595, A0A0S2Z3G4
• Cytogenetics: 9q21.11
• Summary: 'This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]'
• Protein Families: Druggable Genome