Frataxin (FXN) (NM_000144) Human Recombinant Protein

CAT#: TP304880

Recombinant protein of human frataxin (FXN), nuclear gene encoding mitochondrial protein, transcript variant 1

Product Images

Coomassie blue staining of purified FXN protein (Cat# TP304880). The protein was produced from HEK293T cells transfected with FXN cDNA clone (Cat# RC204880) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204880 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWTLGRRAVAGLLASPSPAQAQTLTRVPRPAELAPLCGRRGLRTDIDATCTPRRASSNQRGLNQIWNVKK
  QSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDVSFGSGVLTVKLGGDL
  GTYVINKQTPNKQIWLSSPSSGPKRYDWTGKNWVYSHDGVSLHELLAAELTKALKTKLDLSSLAYSGKDA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_000135
• Locus ID: 2395
• UniProt ID: Q16595, A0A0S2Z3G4
• Cytogenetics: 9q21.11
• Refseq Size: 7168
• Refseq ORF: 630
• Synonyms: CyaY; FA; FARR; FRDA; X25
• Summary: This nuclear gene encodes a mitochondrial protein which belongs to the FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA from 8-33 repeats to >90 repeats results in Friedreich ataxia. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2016]
• Protein Families: Druggable Genome