VAMP5 (NM_006634) Human Mass Spec Standard

CAT#: PH304973

VAMP5 MS Standard C13 and N15-labeled recombinant protein (NP_006625)

Product Images

Coomassie blue staining of purified VAMP5 protein (Cat# TP304973). The protein was produced from HEK293T cells transfected with VAMP5 cDNA clone (Cat# RC204973) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC204973
• Predicted MW: 12.8 kDa
• Protein Sequence:
  Sequence Link

  >RC204973 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
  ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006625
• RefSeq Size: 694
• RefSeq ORF: 348
• Synonyms: MYOBREVIN; myobrevin; vesicle-associated membrane protein 5; vesicle-associated membrane protein 5 (myobrevin)
• Locus ID: 10791
• UniProt ID: O95183, Q6FG93
• Cytogenetics: 2p11.2
• Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport