VAMP5 (NM_006634) Human Recombinant Protein

CAT#: TP304973

Recombinant protein of human vesicle-associated membrane protein 5 (myobrevin) (VAMP5)

Product Images

Coomassie blue staining of purified VAMP5 protein (Cat# TP304973). The protein was produced from HEK293T cells transfected with VAMP5 cDNA clone (Cat# RC204973) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204973 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYR
  ICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006625
• Locus ID: 10791
• UniProt ID: O95183, Q6FG93
• Cytogenetics: 2p11.2
• Refseq Size: 694
• Refseq ORF: 348
• Summary: Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of vesicles and cell membranes. The VAMP5 gene is a member of the vesicle-associated membrane protein (VAMP)/synaptobrevin family and the SNARE superfamily. This VAMP family member may participate in vesicle trafficking events that are associated with myogenesis. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport