TWIST2 (NM_057179) Human Mass Spec Standard
CAT#: PH305006
TWIST2 MS Standard C13 and N15-labeled recombinant protein (NP_476527)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205006 |
Predicted MW | 18.1 kDa |
Protein Sequence |
>RC205006 protein sequence
Red=Cloning site Green=Tags(s) MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL ANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHER LSYAFSVWRMEGAWSMSASH myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_476527 |
RefSeq Size | 1186 |
RefSeq ORF | 480 |
Synonyms | AMS; BBRSAY; bHLHa39; DERMO1; FFDD3; SETLSS |
Locus ID | 117581 |
UniProt ID | Q8WVJ9, A1MB48 |
Cytogenetics | 2q37.3 |
Summary | The protein encoded by this gene is a basic helix-loop-helix type transcription factor and shares similarity with Twist. This protein may inhibit osteoblast maturation and maintain cells in a preosteoblast phenotype during osteoblast development. This gene may be upregulated in certain cancers. Mutations in this gene cause focal facial dermal dysplasia 3, Setleis type. Two transcript variants encoding the same protein have been found. [provided by RefSeq, Apr 2014] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403298 | TWIST2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403298 | Transient overexpression lysate of twist homolog 2 (Drosophila) (TWIST2) |
USD 396.00 |
|
TP305006 | Recombinant protein of human twist homolog 2 (Drosophila) (TWIST2) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review