AASDHPPT (NM_015423) Human Mass Spec Standard

CAT#: PH305091

AASDHPPT MS Standard C13 and N15-labeled recombinant protein (NP_056238)

Product Images

Coomassie blue staining of purified AASDHPPT protein (Cat# TP305091). The protein was produced from HEK293T cells transfected with AASDHPPT cDNA clone (Cat# RC205091) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205091
• Predicted MW: 35.8 kDa
• Protein Sequence:
  Sequence Link

  >RC205091 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVFPAKRFCLVPSMEGVRWAFSCGTWLPSRAEWLLAVRSIQPEEKERIGQFVFARDAKAAMAGRLMIRKL
  VAEKLNIPWNHIRLQRTAKGKPVLAKDSSNPYPNFNFNISHQGDYAVLAAEPELQVGIDIMKTSFPGRGS
  IPEFFHIMKRKFTNKEWETIRSFKDEWTQLDMFYRNWALKESFIKAIGVGLGFELQRLEFDLSPLNLDIG
  QVYKETRLFLDGEEEKEWAFEESKIDEHHFVAVALRKPDGSRHQDVPSQDDSKPTQRQFTILNFNDLMSS
  AVPMTPEDPSFWDCFCFTEEIPIRNGTKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056238
• RefSeq Size: 2880
• RefSeq ORF: 927
• Synonyms: AASD-PPT; ACPS; CGI-80; LYS2; LYS5
• Locus ID: 60496
• UniProt ID: Q9NRN7
• Cytogenetics: 11q22.3
• Summary: The protein encoded by this gene is similar to Saccharomyces cerevisiae LYS5, which is required for the activation of the alpha-aminoadipate dehydrogenase in the biosynthetic pathway of lysine. Yeast alpha-aminoadipate dehydrogenase converts alpha-biosynthetic-aminoadipate semialdehyde to alpha-aminoadipate. It has been suggested that defects in the human gene result in pipecolic acidemia. [provided by RefSeq, Jul 2008]
• Protein Pathways: Lysine biosynthesis, Lysine degradation, Metabolic pathways