Cofilin 2 (CFL2) (NM_021914) Human Mass Spec Standard
CAT#: PH305105
CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_068733)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205105 |
Predicted MW | 18.7 kDa |
Protein Sequence |
>RC205105 protein sequence
Red=Cloning site Green=Tags(s) MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL DDIKDRSTLGEKLGGNVVVSLEGKPL myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_068733 |
RefSeq Size | 3125 |
RefSeq ORF | 498 |
Synonyms | NEM7 |
Locus ID | 1073 |
UniProt ID | Q9Y281, Q549N0 |
Cytogenetics | 14q13.1 |
Summary | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403364 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC411884 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429663 | CFL2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY403364 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 2 |
USD 396.00 |
|
LY411884 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 1 |
USD 396.00 |
|
LY429663 | Transient overexpression lysate of cofilin 2 (muscle) (CFL2), transcript variant 1 |
USD 396.00 |
|
PH322215 | CFL2 MS Standard C13 and N15-labeled recombinant protein (NP_619579) |
USD 2,055.00 |
|
TP305105 | Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 1 |
USD 823.00 |
|
TP322215 | Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review