Cofilin 2 (CFL2) (NM_021914) Human Recombinant Protein

CAT#: TP305105

Recombinant protein of human cofilin 2 (muscle) (CFL2), transcript variant 1

Product Images

Coomassie blue staining of purified CFL2 protein (Cat# TP305105). The protein was produced from HEK293T cells transfected with CFL2 cDNA clone (Cat# RC205105) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205105 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS
  FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL
  DDIKDRSTLGEKLGGNVVVSLEGKPL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_068733
• Locus ID: 1073
• UniProt ID: Q9Y281, Q549N0
• Cytogenetics: 14q13.1
• Refseq Size: 3125
• Refseq ORF: 498
• Synonyms: NEM7
• Summary: This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2009]
• Protein Families: Druggable Genome
• Protein Pathways: Axon guidance, Fc gamma R-mediated phagocytosis, Regulation of actin cytoskeleton