PHPT1 (NM_014172) Human Mass Spec Standard

CAT#: PH305124

PHPT1 MS Standard C13 and N15-labeled recombinant protein (NP_054891)

Product Images

Coomassie blue staining of purified PHPT1 protein (Cat# TP305124). The protein was produced from HEK293T cells transfected with PHPT1 cDNA clone (Cat# RC205124) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205124
• Predicted MW: 13.8 kDa
• Protein Sequence:
  Sequence Link

  >RC205124 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCD
  CECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054891
• RefSeq Size: 1199
• RefSeq ORF: 375
• Synonyms: CGI-202; HEL-S-132P; HSPC141; PHP; PHP14
• Locus ID: 29085
• UniProt ID: Q9NRX4, V9HWC4
• Cytogenetics: 9q34.3
• Summary: This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism