PHPT1 (NM_014172) Human Recombinant Protein

CAT#: TP305124

Recombinant protein of human phosphohistidine phosphatase 1 (PHPT1), transcript variant 3

Product Images

Coomassie blue staining of purified PHPT1 protein (Cat# TP305124). The protein was produced from HEK293T cells transfected with PHPT1 cDNA clone (Cat# RC205124) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205124 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCD
  CECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054891
• Locus ID: 29085
• UniProt ID: Q9NRX4, V9HWC4
• Cytogenetics: 9q34.3
• Refseq Size: 1199
• Refseq ORF: 375
• Synonyms: CGI-202; HEL-S-132P; HSPC141; PHP; PHP14
• Summary: This gene encodes an enzyme that catalyzes the reversible dephosphorylation of histidine residues in proteins. It may be involved in the dephosphorylation of G-beta and ATP citrate lyase and in negatively regulating CD4 T lymphocytes by dephosphorylation and inhibition of KCa3.1 channels. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]
• Protein Families: Druggable Genome
• Protein Pathways: Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism