PLSCR4 (NM_020353) Human Mass Spec Standard

CAT#: PH305184

PLSCR4 MS Standard C13 and N15-labeled recombinant protein (NP_065086)

Product Images

Coomassie blue staining of purified PLSCR4 protein (Cat# TP305184). The protein was produced from HEK293T cells transfected with PLSCR4 cDNA clone (Cat# RC205184) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205184
• Predicted MW: 37 kDa
• Protein Sequence:
  Sequence Link

  >RC205184 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGVVPTAPEQPAGEMENQTKPPDPRPDAPPEYNSHFLPGPPGTAVPPPTGYPGGLPMGYYSPQQPSTFP
  LYQPVGGIHPVRYQPGKYPMPNQSVPITWMPGPTPMANCPPGLEYLVQLDNIHVLQHFEPLEMMTCFETN
  NRYDIKNNSDQMVYIVTEDTDDFTRNAYRTLRPFVLRVTDCMGREIMTMQRPFRCTCCCFCCPSARQELE
  VQCPPGVTIGFVAEHWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGSIIRKWN
  GLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSPPQRSR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_065086
• RefSeq Size: 3312
• RefSeq ORF: 987
• Synonyms: TRA1
• Locus ID: 57088
• UniProt ID: Q9NRQ2
• Cytogenetics: 3q24
• Summary: May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane. May play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system. [UniProtKB/Swiss-Prot Function]