INSIG2 (NM_016133) Human Mass Spec Standard

CAT#: PH305274

INSIG2 MS Standard C13 and N15-labeled recombinant protein (NP_057217)

Product Images

Coomassie blue staining of purified INSIG2 protein (Cat# TP305274). The protein was produced from HEK293T cells transfected with INSIG2 cDNA clone (Cat# RC205274) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205274
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC205274 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQIQRNVTLFPPDVIASIFSSA
  WWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAAL
  SIGLWWTFDRSRSGFGLGVGIAFLATVVTQLLVYNGVYQYTSPDFLYVRSWLPCIFFAGGITMGNIGRQL
  AMYECKVIAEKSHQE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057217
• RefSeq Size: 2592
• RefSeq ORF: 675
• Synonyms: INSIG-2
• Locus ID: 51141
• UniProt ID: Q9Y5U4, A0A024RAI2
• Cytogenetics: 2q14.1-q14.2
• Summary: The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi. [provided by RefSeq, Jul 2008]
• Protein Families: Transmembrane