SLC30A3 (NM_003459) Human Mass Spec Standard

CAT#: PH305310

SLC30A3 MS Standard C13 and N15-labeled recombinant protein (NP_003450)

Product Images

Coomassie blue staining of purified SLC30A3 protein (Cat# TP305310). The protein was produced from HEK293T cells transfected with SLC30A3 cDNA clone (Cat# RC205310) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205310
• Predicted MW: 41.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205310 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPSPAAGGLETTRLVSPRDRGGAGGSLRLKSLFTEPSEPLPEESKPVEMPFHHCHRDPLPPPGLTPERL
  HARRQLYAACAVCFVFMAGEVVGGYLAHSLAIMTDAAHLLADVGSMMGSLFSLWLSTRPATRTMTFGWHR
  SETLGALASVVSLWMVTGILLYLAFVRLLHSDYHIEGGAMLLTASIAVCANLLMAFVLHQAGPPHSHGSR
  GAEYAPLEEGPEEPLPLGNTSVRAAFVHVLGDLLQSFGVLAASILIYFKPQYKAADPISTFLFSICALGS
  TAPTLRDVLRILMEGTPRNVGFEPVRDTLLSVPGVRATHELHLWALTLTYHVASAHLAIDSTADPEAVLA
  EASSRLYSRFGFSSCTLQVEQYQPEMAQCLRCQEPPQA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003450
• RefSeq Size: 2108
• RefSeq ORF: 1164
• Synonyms: ZNT3
• Locus ID: 7781
• UniProt ID: Q99726
• Cytogenetics: 2p23.3
• Summary: Involved in accumulation of zinc in synaptic vesicles. [UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane