POU3F2 (NM_005604) Human Mass Spec Standard

CAT#: PH305330

POU3F2 MS Standard C13 and N15-labeled recombinant protein (NP_005595)

Product Images

Coomassie blue staining of purified POU3F2 protein (Cat# TP305330). The protein was produced from HEK293T cells transfected with POU3F2 cDNA clone (Cat# RC205330) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205330
• Predicted MW: 46.7 kDa
• Protein Sequence:
  Sequence Link

  >RC205330 representing NM_005604
  Red=Cloning site Green=Tags(s)
  
  MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQWITALSHGGG
  GGGGGGGGGGGGGGGGGGDGSPWSTSPLGQPDIKPSVVVQQGGRGDELHGPGALQQQHQQQQQQQQQQQQ
  QQQQQQQQQRPPHLVHHAANHHPGPGAWRSAAAAAHLPPSMGASNGGLLYSQPSFTVNGMLGAGGQPAGL
  HHHGLRDAHDEPHHADHHPHPHSHPHQQPPPPPPPQGPPGHPGAHHDPHSDEDTPTSDDLEQFAKQFKQR
  RIKLGFTQADVGLALGTLYGNVFSQTTICRFEALQLSFKNMCKLKPLLNKWLEEADSSSGSPTSIDKIAA
  QGRKRKKRTSIEVSVKGALESHFLKCPKPSAQEITSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGGTLP
  GAEDVYGGSRDTPPHHGVQTPVQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005595
• RefSeq Size: 4172
• RefSeq ORF: 1329
• Synonyms: brn-2; BRN2; N-Oct3; oct-7; OCT7; OTF-7; OTF7; POUF3
• Locus ID: 5454
• UniProt ID: P20265
• Cytogenetics: 6q16.1
• Summary: 'This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells. [provided by RefSeq, Mar 2012]'
• Protein Families: Transcription Factors