VILIP1 (VSNL1) (NM_003385) Human Mass Spec Standard
CAT#: PH305337
VSNL1 MS Standard C13 and N15-labeled recombinant protein (NP_003376)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205337 |
| Predicted MW | 22.1 kDa |
| Protein Sequence |
>RC205337 protein sequence
Red=Cloning site Green=Tags(s) MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_003376 |
| RefSeq Size | 2014 |
| RefSeq ORF | 573 |
| Synonyms | HLP3; HPCAL3; HUVISL1; VILIP; VILIP-1 |
| Locus ID | 7447 |
| UniProt ID | P62760 |
| Cytogenetics | 2p24.2 |
| Summary | 'This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC418720 | VSNL1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY418720 | Transient overexpression lysate of visinin-like 1 (VSNL1) |
USD 436.00 |
|
| TP305337 | Recombinant protein of human visinin-like 1 (VSNL1) |
USD 823.00 |
|
| TP720237 | Recombinant protein of human visinin-like 1 (VSNL1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China