VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein

CAT#: TP305337

Recombinant protein of human visinin-like 1 (VSNL1)

Product Images

Coomassie blue staining of purified VSNL1 protein (Cat# TP305337). The protein was produced from HEK293T cells transfected with VSNL1 cDNA clone (Cat# RC205337) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205337 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGKQNSKLAPEVMEDLVKSTEFNEHELKQWYKGFLKDCPSGRLNLEEFQQLYVKFFPYGDASKFAQHAFR
  TFDKNGDGTIDFREFICALSITSRGSFEQKLNWAFNMYDLDGDGKITRVEMLEIIEAIYKMVGTVIMMKM
  NEDGLTPEQRVDKIFSKMDKNKDDQITLDEFKEAAKSDPSIVLLLQCDIQK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: WB positive control (PMID: 29283288)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003376
• Locus ID: 7447
• UniProt ID: P62760
• Cytogenetics: 2p24.2
• Refseq Size: 2014
• Refseq ORF: 573
• Synonyms: HLP3; HPCAL3; HUVISL1; VILIP; VILIP-1
• Summary: This gene is a member of the visinin/recoverin subfamily of neuronal calcium sensor proteins. The encoded protein is strongly expressed in granule cells of the cerebellum where it associates with membranes in a calcium-dependent manner and modulates intracellular signaling pathways of the central nervous system by directly or indirectly regulating the activity of adenylyl cyclase. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome