MAGEB2 (NM_002364) Human Mass Spec Standard

CAT#: PH305338

MAGEB2 MS Standard C13 and N15-labeled recombinant protein (NP_002355)

Product Images

Coomassie blue staining of purified MAGEB2 protein (Cat# TP305338). The protein was produced from HEK293T cells transfected with MAGEB2 cDNA clone (Cat# RC205338) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205338
• Predicted MW: 35.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205338 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAASSSPAAGIPQKPQRAPTTAA
  AAAAGVSSTKSKKGAKSHQGEKNASSSQASTSTKSPSEDPLTRKSGSLVQFLLYKYKIKKSVTKGEMLKI
  VGKRFREHFPEILKKASEGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFPRRKLLMPLLGV
  IFLNGNSATEEEIWEFLNMLGVYDGEEHSVFGEPWKLITKDLVQEKYLEYKQVPSSDPPRFQFLWGPRAY
  AETSKMKVLEFLAKVNGTTPCAFPTHYEEALKDEEKAGV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002355
• RefSeq Size: 1628
• RefSeq ORF: 957
• Synonyms: CT3.2; DAM6; MAGE-XP-2
• Locus ID: 4113
• UniProt ID: O15479, Q53G50
• Cytogenetics: Xp21.2
• Summary: 'This gene is a member of the MAGEB gene family. The members of this family have their entire coding sequences located in the last exon, and the encoded proteins show 50 to 68% sequence identity to each other. The promoters and first exons of the MAGEB genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. This gene is localized in the DSS (dosage-sensitive sex reversal) critical region. It is expressed in testis and placenta, and in a significant fraction of tumors of various histological types. The MAGEB genes are clustered on chromosome Xp22-p21. [provided by RefSeq, Jul 2008]'