YPEL1 (NM_013313) Human Mass Spec Standard

CAT#: PH305359

YPEL1 MS Standard C13 and N15-labeled recombinant protein (NP_037445)

Product Images

Coomassie blue staining of purified YPEL1 protein (Cat# TP305359). The protein was produced from HEK293T cells transfected with YPEL1 cDNA clone (Cat# RC205359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205359
• Predicted MW: 13.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205359 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG
  LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037445
• RefSeq Size: 4301
• RefSeq ORF: 357
• Synonyms: FKSG3
• Locus ID: 29799
• UniProt ID: O60688
• Cytogenetics: 22q11.21-q11.22
• Summary: This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division. [provided by RefSeq, Feb 2015]