YPEL1 (NM_013313) Human Recombinant Protein

CAT#: TP305359

Recombinant protein of human yippee-like 1 (Drosophila) (YPEL1)

Product Images

Coomassie blue staining of purified YPEL1 protein (Cat# TP305359). The protein was produced from HEK293T cells transfected with YPEL1 cDNA clone (Cat# RC205359) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205359 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCGPAEERVLLTG
  LHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_037445
• Locus ID: 29799
• UniProt ID: O60688
• Cytogenetics: 22q11.21-q11.22
• Refseq Size: 4301
• Refseq ORF: 357
• Synonyms: FKSG3
• Summary: This gene is located in the region associated with DiGeorge syndrome on chromosome 22. The encoded protein localizes to the centrosome and nucleolus and may play a role in the regulation of cell division. [provided by RefSeq, Feb 2015]