Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201591) Human Mass Spec Standard

CAT#: PH305371

GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885)

Product Images

Coomassie blue staining of purified GPM6A protein (Cat# TP305371). The protein was produced from HEK293T cells transfected with GPM6A cDNA clone (Cat# RC205371) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205371
• Predicted MW: 31.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205371 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGD
  TLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLA
  WLGVTAFTSLPVYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMT
  FHLFIVALAGAGAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_963885
• RefSeq Size: 3697
• RefSeq ORF: 834
• Synonyms: GPM6; M6A
• Locus ID: 2823
• UniProt ID: P51674
• Cytogenetics: 4q34.2
• Summary: ''
• Protein Families: Transmembrane