Neuronal membrane glycoprotein M6 a (GPM6A) (NM_201592) Human Mass Spec Standard
CAT#: PH313529
GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963886)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC213529 |
Predicted MW | 29.7 kDa |
Protein Sequence |
>RC213529 representing NM_201592
Red=Cloning site Green=Tags(s) MGCFECCIKCLGGIPYASLIATILLYAGVALFCGCGHEALSGTVNILQTYFEMARTAGDTLDVFTMIDIF KYVIYGIAAAFFVYGILLMVEGFFTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLP VYMYFNLWTICRNTTLVEGANLCLDLRQFGIVTIGEEKKICTVSENFLRMCESTELNMTFHLFIVALAGA GAAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_963886 |
RefSeq Size | 2962 |
RefSeq ORF | 801 |
Synonyms | GPM6; M6A |
Locus ID | 2823 |
UniProt ID | P51674 |
Cytogenetics | 4q34.2 |
Summary | '' |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401623 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404475 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC404476 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430884 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430885 | GPM6A HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401623 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 1 |
USD 396.00 |
|
LY404475 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 |
USD 396.00 |
|
LY404476 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 |
USD 396.00 |
|
LY430884 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 2 |
USD 396.00 |
|
LY430885 | Transient overexpression lysate of glycoprotein M6A (GPM6A), transcript variant 3 |
USD 396.00 |
|
PH305371 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_963885) |
USD 2,055.00 |
|
PH305432 | GPM6A MS Standard C13 and N15-labeled recombinant protein (NP_005268) |
USD 2,055.00 |
|
TP305371 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 2 |
USD 823.00 |
|
TP305432 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 1 |
USD 823.00 |
|
TP313529 | Recombinant protein of human glycoprotein M6A (GPM6A), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review