LMO2 (NM_005574) Human Mass Spec Standard

CAT#: PH305376

LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565)

Product Images

Coomassie blue staining of purified LMO2 protein (Cat# TP305376). The protein was produced from HEK293T cells transfected with LMO2 cDNA clone (Cat# RC205376) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205376
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Sequence Link

  >RC205376 representing NM_005574
  Red=Cloning site Green=Tags(s)
  
  MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR
  LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS
  DIVCEQDIYEWTKINGMI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005565
• RefSeq Size: 2304
• RefSeq ORF: 474
• Synonyms: LMO-2; RBTN2; RBTNL1; RHOM2; TTG2
• Locus ID: 4005
• UniProt ID: P25791
• Cytogenetics: 11p13
• Summary: 'LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]'
• Protein Families: Druggable Genome