LMO2 (NM_001142315) Human Mass Spec Standard
CAT#: PH326762
LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135787)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226762 |
Predicted MW | 18.2 kDa |
Protein Sequence |
>RC226762 representing NM_001142315
Red=Cloning site Green=Tags(s) MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLCGCRLGEVGRR LYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECFKCAACQKHFCVGDRYLLINS DIVCEQDIYEWTKINGMI myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001135787 |
RefSeq ORF | 474 |
Synonyms | LMO-2; RBTN2; RBTNL1; RHOM2; TTG2 |
Locus ID | 4005 |
UniProt ID | P25791 |
Cytogenetics | 11p13 |
Summary | 'LMO2 encodes a cysteine-rich, two LIM-domain protein that is required for yolk sac erythropoiesis. The LMO2 protein has a central and crucial role in hematopoietic development and is highly conserved. The LMO2 transcription start site is located approximately 25 kb downstream from the 11p13 T-cell translocation cluster (11p13 ttc), where a number T-cell acute lymphoblastic leukemia-specific translocations occur. Alternative splicing results in multiple transcript variants encoding different isoforms.[provided by RefSeq, Nov 2008]' |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417218 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428033 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428034 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC432149 | LMO2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417218 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
USD 396.00 |
|
LY428033 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2 |
USD 396.00 |
|
LY428034 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3 |
USD 396.00 |
|
LY432149 | Transient overexpression lysate of LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
USD 396.00 |
|
PH305376 | LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_005565) |
USD 2,055.00 |
|
PH326864 | LMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001135788) |
USD 2,055.00 |
|
TP305376 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1 |
USD 823.00 |
|
TP326762 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 2 |
USD 748.00 |
|
TP326864 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 3 |
USD 823.00 |
|
TP329124 | Recombinant protein of human LIM domain only 2 (rhombotin-like 1) (LMO2), transcript variant 1. |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review