PCP2 (NM_174895) Human Mass Spec Standard

CAT#: PH305399

PCP2 MS Standard C13 and N15-labeled recombinant protein (NP_777555)

Product Images

Coomassie blue staining of purified PCP2 protein (Cat# TP305399). The protein was produced from HEK293T cells transfected with PCP2 cDNA clone (Cat# RC205399) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205399
• Predicted MW: 14.5 kDa
• Protein Sequence:
  Sequence Link

  >RC205399 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDML
  ASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_777555
• RefSeq Size: 789
• RefSeq ORF: 408
• Synonyms: GPSM4
• Locus ID: 126006
• UniProt ID: Q8IVA1
• Cytogenetics: 19p13.2