PCP2 (NM_174895) Human Recombinant Protein

CAT#: TP305399

Recombinant protein of human Purkinje cell protein 2 (PCP2)

Product Images

Coomassie blue staining of purified PCP2 protein (Cat# TP305399). The protein was produced from HEK293T cells transfected with PCP2 cDNA clone (Cat# RC205399) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205399 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMDQEEKTEEGSGPCAEAGSPDQEGFFNLLSHVQGDRMEGQRCSLQAGPGQTTKSQSDPTPEMDSLMDML
  ASTQGRRMDDQRVTVSSLPGFQPVGSKDGAQKRAGTLSPQPLLTPQDPTALGFRRNSSPQPPTQAP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_777555
• Locus ID: 126006
• UniProt ID: Q8IVA1
• Cytogenetics: 19p13.2
• Refseq Size: 789
• Refseq ORF: 408
• Synonyms: GPSM4
• Summary: May function as a cell-type specific modulator for G protein-mediated cell signaling.[UniProtKB/Swiss-Prot Function]