VTA1 (NM_016485) Human Mass Spec Standard

CAT#: PH305442

VTA1 MS Standard C13 and N15-labeled recombinant protein (NP_057569)

Product Images

Coomassie blue staining of purified VTA1 protein (Cat# TP305442). The protein was produced from HEK293T cells transfected with VTA1 cDNA clone (Cat# RC205442) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205442
• Predicted MW: 33.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205442 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAALAPLPPLPAQFKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEAL
  KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYTASLLIDVITVFGELTDENVK
  HRKYARWKATYIHNCLKNGETPQAGPVGIEEDNDIEENEDAGAASLPTQPTQPSSSSTYDPSNMPSGNYT
  GIQIPPGAHAPANTPAEVPHSTGVASNTIQPTPQTIPAIDPALFNTISQGDVRLTPEDFARAQKYCKYAG
  SALQYEDVSTAVQNLQKALKLLTTGRE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057569
• RefSeq Size: 3371
• RefSeq ORF: 921
• Synonyms: C6orf55; DRG-1; DRG1; HSPC228; LIP5; My012; SBP1
• Locus ID: 51534
• UniProt ID: Q9NP79
• Cytogenetics: 6q24.1-q24.2
• Summary: C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes (Ward et al., 2005 [PubMed 15644320]). [supplied by OMIM, Mar 2008]
• Protein Pathways: Endocytosis