SLC25A42 (NM_178526) Human Mass Spec Standard

CAT#: PH305444

SLC25A42 MS Standard C13 and N15-labeled recombinant protein (NP_848621)

Product Images

Coomassie blue staining of purified SLC25A42 protein (Cat# TP305444). The protein was produced from HEK293T cells transfected with SLC25A42 cDNA clone (Cat# RC205444) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205444
• Predicted MW: 35.4 kDa
• Protein Sequence:
  Sequence Link

  >RC205444 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSA
  KEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGAL
  AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYET
  LKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGA
  VRGLYKGLSMNWVKGPIAVGISFTTFDLMQIMLRHLQS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_848621
• RefSeq Size: 3279
• RefSeq ORF: 954
• Synonyms: MECREN
• Locus ID: 284439
• UniProt ID: Q86VD7, A0A024R7K2, Q8NHH2
• Cytogenetics: 19p13.11
• Summary: This gene encodes a solute carrier family 25 protein. Solute carrier family 25 proteins are localized to mitochondria and play critical roles in the transport of molecules across the inner mitochondrial membrane. The encoded protein is a mitochondrial transporter for coenzyme A (CoA) and adenosine 3',5'-diphosphate. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome