SLC25A42 (NM_178526) Human Recombinant Protein

CAT#: TP305444

Recombinant protein of human solute carrier family 25, member 42 (SLC25A42)

Product Images

Coomassie blue staining of purified SLC25A42 protein (Cat# TP305444). The protein was produced from HEK293T cells transfected with SLC25A42 cDNA clone (Cat# RC205444) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205444 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGNGVKEGPVRLHEDAEAVLSSSVSSKRDHRQVLSSLLPGALAGALAKTAVAPLDRTKIIFQVSSKRFSA
  KEAFRVLYYTYLNEGFLSLWRGNSATMVRVVPYAAIQFSAHEEYKRILGSYYGFRGEALPPWPRLFAGAL
  AGTTAASLTYPLDLVRARMAVTPKEMYSNIFHVFIRISREEGLKTLYHGFMPTVLGVIPYAGLSFFTYET
  LKSLHREYSGRRQPYPFERMIFGACAGLIGQSASYPLDVVRRRMQTAGVTGYPRASIARTLRTIVREEGA
  VRGLYKGLSMNWVKGPIAVGISFTTFDLMQIMLRHLQS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 35.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_848621
• Locus ID: 284439
• UniProt ID: Q86VD7, A0A024R7K2, Q8NHH2
• Cytogenetics: 19p13.11
• Refseq Size: 3279
• Refseq ORF: 954
• Synonyms: MECREN
• Summary: This gene encodes a solute carrier family 25 protein. Solute carrier family 25 proteins are localized to mitochondria and play critical roles in the transport of molecules across the inner mitochondrial membrane. The encoded protein is a mitochondrial transporter for coenzyme A (CoA) and adenosine 3',5'-diphosphate. [provided by RefSeq, Feb 2012]
• Protein Families: Druggable Genome