WBP2NL (NM_152613) Human Mass Spec Standard

CAT#: PH305495

WBP2NL MS Standard C13 and N15-labeled recombinant protein (NP_689826)

Product Images

Coomassie blue staining of purified WBP2NL protein (Cat# TP305495). The protein was produced from HEK293T cells transfected with WBP2NL cDNA clone (Cat# RC205495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205495
• Predicted MW: 31.9 kDa
• Protein Sequence:
  Sequence Link

  >RC205495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPM
  LSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGF
  PLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGY
  RASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGS
  GARPHESTAAQAPENEASLPSASSSQVHS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_689826
• RefSeq Size: 2330
• RefSeq ORF: 927
• Synonyms: GRAMD7; PAWP
• Locus ID: 164684
• UniProt ID: Q6ICG8
• Cytogenetics: 22q13.2
• Summary: WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]). [supplied by OMIM, Mar 2008]