WBP2NL (NM_152613) Human Recombinant Protein

CAT#: TP305495

Recombinant protein of human WBP2 N-terminal like (WBP2NL)

Product Images

Coomassie blue staining of purified WBP2NL protein (Cat# TP305495). The protein was produced from HEK293T cells transfected with WBP2NL cDNA clone (Cat# RC205495) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205495 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVNQSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPM
  LSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGGAIEFAQLMVKAASAAARGF
  PLRTLNDWFSSMGIYVITGEGNMCTPQMPCSVIVYGAPPAGYGAPPPGYGAPPAGYGAQPVGNEGPPVGY
  RASPVRYGAPPLGYGAPPAGYGAPPLGYGAPPLGYGTPPLGYGAPPLGYGAPPAGNEGPPAGYRASPAGS
  GARPHESTAAQAPENEASLPSASSSQVHS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 31.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_689826
• Locus ID: 164684
• UniProt ID: Q6ICG8
• Cytogenetics: 22q13.2
• Refseq Size: 2330
• Refseq ORF: 927
• Synonyms: GRAMD7; PAWP
• Summary: WBP2NL is a sperm-specific WW domain-binding protein that promotes meiotic resumption and pronuclear development during oocyte fertilization (Wu et al., 2007 [PubMed 17289678]).[supplied by OMIM, Mar 2008]