C1orf19 (TSEN15) (NM_052965) Human Mass Spec Standard

CAT#: PH305519

TSEN15 MS Standard C13 and N15-labeled recombinant protein (NP_443197)

Product Images

Coomassie blue staining of purified TSEN15 protein (Cat# TP305519). The protein was produced from HEK293T cells transfected with TSEN15 cDNA clone (Cat# RC205519) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205519
• Predicted MW: 18.6 kDa
• Protein Sequence:
  Sequence Link

  >RC205519 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL
  MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT
  LAIVESDSTIVYYKLTDGFMLPDPQNISLRR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_443197
• RefSeq Size: 1998
• RefSeq ORF: 513
• Synonyms: C1orf19; PCH2F; sen15
• Locus ID: 116461
• UniProt ID: Q8WW01, B1ALV0
• Cytogenetics: 1q25.3
• Summary: This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by RefSeq, Jul 2014]