C1orf19 (TSEN15) (NM_052965) Human Recombinant Protein

CAT#: TP305519

Recombinant protein of human tRNA splicing endonuclease 15 homolog (S. cerevisiae) (TSEN15), transcript variant 1

Product Images

Coomassie blue staining of purified TSEN15 protein (Cat# TP305519). The protein was produced from HEK293T cells transfected with TSEN15 cDNA clone (Cat# RC205519) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205519 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEERGDSEPTPGCSGLGPGGVRGFGDGGGAPSWAPEDAWMGTHPKYLEMMELDIGDATQVYVAFLVYLDL
  MESKSWHEVNCVGLPELQLICLVGTEIEGEGLQTVVPTPITASLSHNRIREILKASRKLQGDPDLPMSFT
  LAIVESDSTIVYYKLTDGFMLPDPQNISLRR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_443197
• Locus ID: 116461
• UniProt ID: Q8WW01, B1ALV0
• Cytogenetics: 1q25.3
• Refseq Size: 1998
• Refseq ORF: 513
• Synonyms: C1orf19; PCH2F; sen15
• Summary: This gene encodes a subunit of the tRNA splicing endonuclease, which catalyzes the removal of introns from tRNA precursors. Alternative splicing results in multiple transcript variants. There is a pseudogene of this gene on chromosome 17. [provided by RefSeq, Jul 2014]