RND1 (NM_014470) Human Mass Spec Standard

CAT#: PH305535

RND1 MS Standard C13 and N15-labeled recombinant protein (NP_055285)

Product Images

Coomassie blue staining of purified RND1 protein (Cat# TP305535). The protein was produced from HEK293T cells transfected with RND1 cDNA clone (Cat# RC205535) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205535
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205535 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG
  SPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS
  HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHL
  PSRSELISSTFKKEKAKSCSIM
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055285
• RefSeq Size: 1665
• RefSeq ORF: 696
• Synonyms: ARHS; RHO6; RHOS
• Locus ID: 27289
• UniProt ID: Q92730
• Cytogenetics: 12q13.12
• Summary: This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension. [provided by RefSeq, Apr 2014]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Axon guidance