RND1 (NM_014470) Human Recombinant Protein

CAT#: TP305535

Recombinant protein of human Rho family GTPase 1 (RND1)

Product Images

Coomassie blue staining of purified RND1 protein (Cat# TP305535). The protein was produced from HEK293T cells transfected with RND1 cDNA clone (Cat# RC205535) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205535 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG
  SPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS
  HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHL
  PSRSELISSTFKKEKAKSCSIM
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 25.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055285
• Locus ID: 27289
• UniProt ID: Q92730
• Cytogenetics: 12q13.12
• Refseq Size: 1665
• Refseq ORF: 696
• Synonyms: ARHS; RHO6; RHOS
• Summary: This gene encodes a protein that belongs to the Rho GTPase family. Members of this family regulate the organization of the actin cytoskeleton in response to extracellular growth factors. A similar protein in rat interacts with a microtubule regulator to control axon extension. [provided by RefSeq, Apr 2014]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: Axon guidance