SLC35G2 (NM_025246) Human Mass Spec Standard
CAT#: PH305536
TMEM22 MS Standard C13 and N15-labeled recombinant protein (NP_079522)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205536 |
Predicted MW | 46.5 kDa |
Protein Sequence |
>RC205536 protein sequence
Red=Cloning site Green=Tags(s) MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR SVFQVLSVLVVCYYEEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_079522 |
RefSeq Size | 2079 |
RefSeq ORF | 1236 |
Synonyms | TMEM22 |
Locus ID | 80723 |
UniProt ID | Q8TBE7 |
Cytogenetics | 3q22.3 |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410808 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420393 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420394 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425990 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC425991 | SLC35G2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410808 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 1 |
USD 396.00 |
|
LY420393 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 2 |
USD 396.00 |
|
LY420394 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 3 |
USD 396.00 |
|
LY425990 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 2 |
USD 396.00 |
|
LY425991 | Transient overexpression lysate of transmembrane protein 22 (TMEM22), transcript variant 3 |
USD 396.00 |
|
TP305536 | Recombinant protein of human transmembrane protein 22 (TMEM22), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review