SLC35G2 (NM_025246) Human Recombinant Protein

CAT#: TP305536

Recombinant protein of human transmembrane protein 22 (TMEM22), transcript variant 1

Product Images

Coomassie blue staining of purified SLC35G2 protein (Cat# TP305536). The protein was produced from HEK293T cells transfected with SLC35G2 cDNA clone (Cat# RC205536) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205536 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDTSPSRKYPVKKRVKIHPNTVMVKYTSHYPQPGDDGYEEINEGYGNFMEENPKKGLLSEMKKKGRAFFG
  TMDTLPPPTEDPMINEIGQFQSFAEKNIFQSRKMWIVLFGSALAHGCVALITRLVSDRSKVPSLELIFIR
  SVFQVLSVLVVCYYEEAPFGPSGYRLRLFFYGVCNVISITCAYTSFSIVPPSNGTTMWRATTTVFSAILA
  FLLVDEKMAYVDMATVVCSILGVCLVMIPNIVDEDNSLLNAWKEAFGYTMTVMAGLTTALSMIVYRSIKE
  KISMWTALFTFGWTGTIWGISTMFILQEPIIPLDGETWSYLIAICVCSTAAFLGVYYALDKFHPALVSTV
  QHLEIVVAMVLQLLVLHIFPSIYDVFGGVIIMISVFVLAGYKLYWRNLRRQDYQEILDSPIK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 46.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_079522
• Locus ID: 80723
• UniProt ID: Q8TBE7
• Cytogenetics: 3q22.3
• Refseq Size: 2079
• Refseq ORF: 1236
• Synonyms: TMEM22
• Summary: May play a role in cell proliferation.[UniProtKB/Swiss-Prot Function]
• Protein Families: Transmembrane