BCAS2 (NM_005872) Human Mass Spec Standard
CAT#: PH305615
BCAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005863)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205615 |
Predicted MW | 26.1 kDa |
Protein Sequence |
>RC205615 protein sequence
Red=Cloning site Green=Tags(s) MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK QQHGEANKENIRQDF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_005863 |
RefSeq Size | 1310 |
RefSeq ORF | 675 |
Synonyms | DAM1; Snt309; SPF27 |
Locus ID | 10286 |
UniProt ID | O75934, B2R7W3 |
Cytogenetics | 1p13.2 |
Summary | Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR). [UniProtKB/Swiss-Prot Function] |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417014 | BCAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY417014 | Transient overexpression lysate of breast carcinoma amplified sequence 2 (BCAS2) |
USD 325.00 |
|
TP305615 | Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2) |
USD 823.00 |
|
TP720563 | Recombinant protein of human breast carcinoma amplified sequence 2 (BCAS2) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review