BCAS2 (NM_005872) Human Mass Spec Standard

CAT#: PH305615

BCAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005863)

Product Images

Coomassie blue staining of purified BCAS2 protein (Cat# TP305615). The protein was produced from HEK293T cells transfected with BCAS2 cDNA clone (Cat# RC205615) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205615
• Predicted MW: 26.1 kDa
• Protein Sequence:
  Sequence Link

  >RC205615 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEF
  ERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNE
  NLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIK
  QQHGEANKENIRQDF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005863
• RefSeq Size: 1310
• RefSeq ORF: 675
• Synonyms: DAM1; Snt309; SPF27
• Locus ID: 10286
• UniProt ID: O75934, B2R7W3
• Cytogenetics: 1p13.2
• Summary: Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. May have a scaffolding role in the spliceosome assembly as it contacts all other components of the core complex. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR). [UniProtKB/Swiss-Prot Function]
• Protein Pathways: Spliceosome