Prolactin (PRL) (NM_000948) Human Mass Spec Standard
CAT#: PH305627
PRL MS Standard C13 and N15-labeled recombinant protein (NP_000939)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC205627 |
| Predicted MW | 25.9 kDa |
| Protein Sequence |
>RC205627 protein sequence
Red=Cloning site Green=Tags(s) MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI DNYLKLLKCRIIHNNNC myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_000939 |
| RefSeq Size | 1371 |
| RefSeq ORF | 681 |
| Synonyms | GHA1 |
| Locus ID | 5617 |
| UniProt ID | P01236, Q5THQ0 |
| Cytogenetics | 6p22.3 |
| Summary | 'This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]' |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424443 | PRL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC431796 | PRL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY424443 | Transient overexpression lysate of prolactin (PRL), transcript variant 1 |
USD 436.00 |
|
| LY431796 | Transient overexpression lysate of prolactin (PRL), transcript variant 2 |
USD 436.00 |
|
| TP305627 | Recombinant protein of human prolactin (PRL) |
USD 823.00 |
|
| TP328768 | Recombinant protein of human prolactin (PRL), transcript variant 2. |
USD 748.00 |
|
| TP723369 | Purified recombinant protein of Human prolactin (PRL), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China