Prolactin (PRL) (NM_000948) Human Recombinant Protein
CAT#: TP305627
Recombinant protein of human prolactin (PRL)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC205627 protein sequence
Red=Cloning site Green=Tags(s) MNIKGSPWKGSLLLLLVSNLLLCQSVAPLPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDK RYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAI LSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKI DNYLKLLKCRIIHNNNC myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000939 |
Locus ID | 5617 |
UniProt ID | P01236, Q5THQ0 |
Cytogenetics | 6p22.3 |
Refseq Size | 1371 |
Refseq ORF | 681 |
Synonyms | GHA1 |
Summary | This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway, Neuroactive ligand-receptor interaction |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424443 | PRL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC431796 | PRL HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY424443 | Transient overexpression lysate of prolactin (PRL), transcript variant 1 |
USD 325.00 |
|
LY431796 | Transient overexpression lysate of prolactin (PRL), transcript variant 2 |
USD 325.00 |
|
PH305627 | PRL MS Standard C13 and N15-labeled recombinant protein (NP_000939) |
USD 2,055.00 |
|
TP328768 | Recombinant protein of human prolactin (PRL), transcript variant 2. |
USD 748.00 |
|
TP723369 | Purified recombinant protein of Human prolactin (PRL), transcript variant 1. |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review