TIMM10 (NM_012456) Human Mass Spec Standard

CAT#: PH305668

TIMM10 MS Standard C13 and N15-labeled recombinant protein (NP_036588)

Product Images

Coomassie blue staining of purified TIMM10 protein (Cat# TP305668). The protein was produced from HEK293T cells transfected with TIMM10 cDNA clone (Cat# RC205668) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC205668
• Predicted MW: 10.3 kDa
• Protein Sequence:
  Sequence Link

  >RC205668 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLT
  ELSMQDEELMKRVQQSSGPA
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_036588
• RefSeq Size: 684
• RefSeq ORF: 270
• Synonyms: TIM10; TIM10A; TIMM10A
• Locus ID: 26519
• UniProt ID: P62072
• Cytogenetics: 11q12.1
• Summary: The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins. [provided by RefSeq, Nov 2011]