TIMM10 (NM_012456) Human Recombinant Protein

CAT#: TP305668

Recombinant protein of human translocase of inner mitochondrial membrane 10 homolog (yeast) (TIMM10), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified TIMM10 protein (Cat# TP305668). The protein was produced from HEK293T cells transfected with TIMM10 cDNA clone (Cat# RC205668) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205668 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLT
  ELSMQDEELMKRVQQSSGPA
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_036588
• Locus ID: 26519
• UniProt ID: P62072
• Cytogenetics: 11q12.1
• Refseq Size: 684
• Refseq ORF: 270
• Synonyms: TIM10; TIM10A; TIMM10A
• Summary: The mitochondrial protein encoded by this gene belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane, functioning as intermembrane space chaperones for the highly insoluble carrier proteins. [provided by RefSeq, Nov 2011]