ADRM1 (NM_175573) Human Mass Spec Standard
CAT#: PH305671
ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_783163)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC205671 |
Predicted MW | 42.2 kDa |
Protein Sequence |
>RC205671 protein sequence
Red=Cloning site Green=Tags(s) MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFCWKDRTSGNVE DDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEHCRKVNEYLNNPPMPGALGAS GSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGLGGLGALTGPGLASLLGSSGPPGSSSSSSSR SQSAAVTPSSTTSSTRATPAPSAPAAASATSPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGP AGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASG QLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_783163 |
RefSeq Size | 1492 |
RefSeq ORF | 1221 |
Synonyms | ARM-1; ARM1; GP110 |
Locus ID | 11047 |
UniProt ID | Q16186 |
Cytogenetics | 20q13.33 |
Summary | This gene encodes a member of the adhesion regulating molecule 1 protein family. The encoded protein is a component of the proteasome where it acts as a ubiquitin receptor and recruits the deubiquitinating enzyme, ubiquitin carboxyl-terminal hydrolase L5. Increased levels of the encoded protein are associated with increased cell adhesion, which is likely an indirect effect of this intracellular protein. Dysregulation of this gene has been implicated in carcinogenesis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013] |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402072 | ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC406279 | ADRM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402072 | Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 1 |
USD 396.00 |
|
LY406279 | Transient overexpression lysate of adhesion regulating molecule 1 (ADRM1), transcript variant 2 |
USD 396.00 |
|
PH315635 | ADRM1 MS Standard C13 and N15-labeled recombinant protein (NP_008933) |
USD 2,055.00 |
|
TP305671 | Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 2 |
USD 823.00 |
|
TP315635 | Recombinant protein of human adhesion regulating molecule 1 (ADRM1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review